PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G016600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family HD-ZIP
Protein Properties Length: 231aa    MW: 25594.5 Da    PI: 6.2886
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G016600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.52.6e-1986139356
                        --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        k+ ++tkeq++ Lee F++nr ++a+++  LA +lgL+ rqV vWFqNrRa+ k
  Aqcoe3G016600.1.p  86 KKLRLTKEQTDLLEESFKQNRVLNAKQKDALAFQLGLKPRQVEVWFQNRRARTK 139
                        56789***********************************************98 PP

2HD-ZIP_I/II112.33.1e-3685174191
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                        +kk+rl+keq  lLEesF++++ L+ ++K +la +Lgl+prqv+vWFqnrRARtk+kq+E+++e+Lk ++ +l+een+rL++e e+Lr +l
  Aqcoe3G016600.1.p  85 NKKLRLTKEQTDLLEESFKQNRVLNAKQKDALAFQLGLKPRQVEVWFQNRRARTKLKQTEMECEYLKICFTTLTEENKRLQREAEQLR-AL 174
                        59*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-1862142IPR009057Homeodomain-like
SuperFamilySSF466893.47E-1973142IPR009057Homeodomain-like
PROSITE profilePS5007116.89281141IPR001356Homeobox domain
SMARTSM003895.1E-1683145IPR001356Homeobox domain
PfamPF000461.4E-1686139IPR001356Homeobox domain
CDDcd000866.07E-1586142No hitNo description
PRINTSPR000315.6E-5112121IPR000047Helix-turn-helix motif
PROSITE patternPS000270116139IPR017970Homeobox, conserved site
PRINTSPR000315.6E-5121137IPR000047Helix-turn-helix motif
SMARTSM003409.2E-15141184IPR003106Leucine zipper, homeobox-associated
PfamPF021834.9E-7141174IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MASLHSSCSL ELSVSVPGFT SSSASLHSTT GDGSAKRDFD INEVPLTMEE DQESWLAKAN  60
DDKYEEQDSG GGGGGGGGDG YGSSNKKLRL TKEQTDLLEE SFKQNRVLNA KQKDALAFQL  120
GLKPRQVEVW FQNRRARTKL KQTEMECEYL KICFTTLTEE NKRLQREAEQ LRALRRVGQP  180
PNNCEPLPAE STLTMCPRCE RVTSRSSSST SNELRHSPQP SAYCPEVLRI *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1133141RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010657445.13e-71PREDICTED: homeobox-leucine zipper protein HOX3
SwissprotQ0JKX15e-60HOX3_ORYSJ; Homeobox-leucine zipper protein HOX3
SwissprotQ9XH385e-60HOX3_ORYSI; Homeobox-leucine zipper protein HOX3
TrEMBLA0A0L9VAC19e-72A0A0L9VAC1_PHAAN; Uncharacterized protein
STRINGVIT_01s0011g04870.t011e-70(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01430.16e-53homeobox-leucine zipper protein 17